Recombinant Escherichia coli Modification methylase EcoRV(ecoRVM)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Escherichia coli Modification methylase EcoRV(ecoRVM)

CSB-EP366147ENL
Regular price
£631.00 GBP
Sale price
£631.00 GBP
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: P04393

Gene Names: ecoRVM

Organism: Escherichia coli

AA Sequence: MKDKVFVPPIKSQGIKTKLVPCIKRIVPKNFNGVWVEPFMGTGVVAFNVAPKDALLCDTNPHLISFYNALKNKDITGDLVKDFLYREGEKLLLSNGEYYYEVRERFNNYKEPLDFLFLNRSCFNGMIRFNSKGGFNVPFCKKPNRFAQAYITKISNQVDRISEIISKGNYTFLCQSFEKTIGMVNRDDVVYCDPPYIGRHVDYFNSWGERDERLLFETLSSLNATFITSTWHHNDYRENKYVRDLWSSFRILTKEHFYHVGASEKNRSPMVEALITNIAKDIIDHIEKSSGDILVIEE

Expression Region: 1-298aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 50.6 kDa

Alternative Name(s): Adenine-specific methyltransferase EcoRV

Relevance: This methylase recognizes the double-stranded sequence GATATC, causes specific methylation on A-2 on both strands, and protects the DNA from cleavage by the EcoRV endonuclease.

Reference: Characterization of the genes coding for the Eco RV restriction and modification system of Escherichia coli.Bougueleret L., Schwarzstein M., Tsugita A., Zabeau M.Nucleic Acids Res. 12:3659-3676(1984)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share