Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: Yes
Lead time: 3-7 working days
Research Topic: Others
Uniprot ID: P06717
Gene Names: eltA
Organism: Escherichia coli
AA Sequence: NGDRLYRADSRPPDEIKRSGGLMPRGHNEYFDRGTQMNINLYDHARGTQTGFVRYDDGYVSTSLSLRSAHLAGQSILSGYSTYYIYVIATAPNMFNVNDVLGVYSPHPYEQEVSALGGIPYSQIYGWYRVNFGVIDERLHRNREYRDRYYRNLNIAPAEDGYRLAGFPPDHQAWREEPWIHHAPQGCGNSSRTITGDTCNEETQNLSTIYLREYQSKVKRQIFSDYQSEVDIYNRIRDEL
Expression Region: 19-258aa
Sequence Info: Full Length of Mature Protein
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged and C-terminal Myc-tagged
MW: 45.3 kDa
Alternative Name(s): LT-A, porcine LTP-A
Relevance: The biological activity of the toxin is produced by the A chain, which activates intracellular adenyl cyclase.
Reference: "Evolutionary origin of pathogenic determinants in enterotoxigenic Escherichia coli and Vibrio cholerae O1." Yamamoto T., Gojobori T., Yokota T. J. Bacteriol. 169:1352-1357(1987)
Purity: Greater than 85% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer，50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.