Recombinant Enterobacteria phage T7 Single-stranded DNA-binding protein gp2.5(2.5)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Enterobacteria phage T7 Single-stranded DNA-binding protein gp2.5(2.5)

CSB-EP366021EEB
Regular price
£667.00 GBP
Sale price
£667.00 GBP
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: P03696

Gene Names: 2,5

Organism: Enterobacteria phage T3 (Bacteriophage T3)

AA Sequence: MAKKIFTSALGTAEPYAYIAKPDYGNEERGFGNPRGVYKVDLTIPNKDPRCQRMVDEIVKCHEEAYAAAVEEYEANPPAVARGKKPLKPYEGDMPFFDNGDGTTTFKFKCYASFQDKKTKETKHINLVVVDSKGKKMEDVPIIGGGSKLKVKYSLVPYKWNTAVGASVKLQLESVMLVELATFGGGEDDWADEVEENGYVASGSAKASKPRDEESWDEDDEESEEADEDGDF

Expression Region: 1-232aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 41.9 kDa

Alternative Name(s): Single-stranded DNA-binding protein ;SSB protein

Relevance: Helix-destabilizing protein, which is expressed in the late stage of lytic development, binds preferentially to single-stranded DNA. It is implicated in DNA replication, recombination, and repair.

Reference: Sequence of bacteriophage T3 DNA from gene 2.5 through gene 9.Beck P.J., Gonzalez S., Ward C.L., Molineux I.J.J. Mol. Biol. 210:687-701(1989)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share