
>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20170405
Research areas: Others
Target / Protein: uvsY
Biologically active: Not Tested
Expression system: E.coli
Species of origin: Enterobacteria phage T4 (Bacteriophage T4)
Delivery time: 3-7 business days
Uniprot ID: P04537
AA Sequence: MRLEDLQEELKKDVFIDSTKLQYEAANNVMLYSKWLNKHSSIKKEMLRIEAQKKVALKARLDYYSGRGDGDEFSMDRYEKSEMKTVLSADKDVLKVDTSLQYWGILLDFCSGALDAIKSRGFAIKHIQDMRAFEAGK
Tag info: N-terminal 6xHis-SUMO-tagged
Expression Region: 1-137aa
Protein length: Full Length
MW: 31.8 kDa
Alternative Name(s):
Relevance: Plays a role in viral DNA synthesis by promoting enzymatic activities of UvsX recombinase, by promoting UvsX-ssDNA filament assembly, and by helping UvsX to displace bound gp32 from ssDNA.
Reference: "Two bacteriophage T4 base plate genes (25 and 26) and the DNA repair gene uvsY belong to spatially and temporally overlapping transcription units."Gruidl M.E., Chen T.C., Gargano S., Storlazzi A., Cascino A., Mosig G.Virology 184:359-369(1991)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Enterobacteria phage T4 Recombination protein uvsY(uvsY)
- Regular price
- £632.00 GBP
- Sale price
- £632.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Enterobacteria phage T4 Recombination and repair protein(UVSX)
- Regular price
- £632.00 GBP
- Sale price
- £632.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Enterobacteria phage T4 Recombination and repair protein(UVSX)
- Regular price
- £632.00 GBP
- Sale price
- £632.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Enterobacteria phage T7 Single-stranded DNA-binding protein gp2.5(2.5)
- Regular price
- £632.00 GBP
- Sale price
- £632.00 GBP
- Regular price
-
- Unit price
- per
Sold out