Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: Yes
Lead time: 3-7 working days
Research Topic: Others
Uniprot ID: Q9XSR0
Gene Names: IL18
Organism: Canis lupus familiaris (Dog) (Canis familiaris)
AA Sequence: YFGKLEPKLSIIRNLNDQVLFVNEGNQPVFEDMPDSDCTDNAPHTIFIIYMYKDSLTRGLAVTISVKYKTMSTLSCKNKTISFQKMSPPDSINDEGNDIIFFQRSVPGHDDKIQFESSLYKGHFLACKKENDLFKLILKDKDENGDKSIMFTVQNKS
Expression Region: 37-193aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal 6xHis-tagged
MW: 22 kDa
Alternative Name(s): Interferon gamma-inducing factor ;IFN-gamma-inducing factorInterleukin-1 gamma ;IL-1 gamma
Relevance: Augments natural killer cell activity in spleen cells and stimulates interferon gamma production in T-helper type I cells.
Reference: Cloning, sequencing, and characterization of dog interleukin-18.Argyle D.J., McGillivery C., Nicolson L., Onions D.E.Immunogenetics 49:541-543(1999)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.