Recombinant Dendroaspis polylepis polylepis Toxin MIT1

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Dendroaspis polylepis polylepis Toxin MIT1

CSB-EP326235DBI
Regular price
£630.00 GBP
Sale price
£630.00 GBP
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: P25687

Gene Names: N/A

Organism: Dendroaspis polylepis polylepis (Black mamba)

AA Sequence: AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSKS

Expression Region: 1-81aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 24.6 kDa

Alternative Name(s): Short name: MIT 1 Alternative name(s): Black mamba intestinal toxin 1 Black mamba venom protein A

Relevance: Potently contracts gastrointestinal (GI) smooth muscle. The receptor for this toxin is present both in the CNS and in the smooth muscle and may be a potassium channel.

Reference: "MIT1, a black mamba toxin with a new and highly potent activity on intestinal contraction."Schweitz H., Pascaud P., Diochot S., Moinier D., Lazdunski M.FEBS Lett. 461:183-188(1999)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

You may also like

  • Recombinant Androctonus australis Alpha-mammal toxin AaH2
    Regular price
    £630.00 GBP
    Sale price
    £630.00 GBP
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Chironex fleckeri Toxin CfTx-1,partial
    Regular price
    £536.00 GBP
    Sale price
    £536.00 GBP
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Mouse Decorin(Dcn) ,partial
    Regular price
    £536.00 GBP
    Sale price
    £536.00 GBP
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Leiurus quinquestriatus hebraeus Alpha-insect toxin LqhaIT
    Regular price
    £630.00 GBP
    Sale price
    £630.00 GBP
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share