Recombinant Crotalus adamanteus Thrombin-like enzyme crotalase(SVTLE)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Crotalus adamanteus Thrombin-like enzyme crotalase(SVTLE)

CSB-EP520546DYB
Regular price
£667.00 GBP
Sale price
£667.00 GBP
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: F8S114

Gene Names: SVTLE

Organism: Crotalus adamanteus (Eastern diamondback rattlesnake)

AA Sequence: VIGGDECNINEHRFLVALYDYWSQSFLCGGTLINEEWVLTAKHCDRTHILIYVGVHDRSVQFDKEQRRFPKEKYFFDCSNNFTKWDKDIMLIRLNKPVSYSEHIAPLSLPSSPPIVGSVCRAMGWGQTTSPQETLPDVPHCANINLLDYEVCRTAHPQFRLPATSRTLCAGVLEGGIDTCNRDSGGPLICNGQFQGIVFWGPDPCAQPDKPGLYTKVFDHLDWIQSIIAGEKTVNCPP

Expression Region: 25-262aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 42.8 kDa

Alternative Name(s):

Relevance: Thrombin-like snake venom protein that release fibrinopeptide A from fibrinogen (FGA). Shows both kinin-releasing and coagulant activities.

Reference: A high-throughput venom-gland transcriptome for the eastern diamondback rattlesnake (Crotalus adamanteus) and evidence for pervasive positive selection across toxin classes.Rokyta D.R., Wray K.P., Lemmon A.R., Lemmon E.M., Caudle S.B.Toxicon 57:657-671(2011)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share