Recombinant Coturnix delegorguei Ovomucoid

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Coturnix delegorguei Ovomucoid

CSB-EP356564CRB
Regular price
£648.00 GBP
Sale price
£648.00 GBP
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170725

Research areas: others

Target / Protein:

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Coturnix delegorguei (Harlequin quail)

Delivery time: 3-7 business days

Uniprot ID: P05600

AA Sequence: SVDCSEYPKPACPKDYRPVCGSDNKTYGNKCNFCNAVVESNGTLTLNRFGKC

Tag info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Expression Region: 1-52aa

Protein length: Full Length of Mature Protein

MW: 25.7 kDa

Alternative Name(s):

Relevance:

Reference: "Ovomucoid third domains from 100 avian species: isolation, sequences, and hypervariability of enzyme-inhibitor contact residues." Laskowski M. Jr., Kato I., Ardelt W., Cook J., Denton A., Empie M.W., Kohr W.J., Park S.J., Parks K., Schatzley B.L., Schoenberger O.L., Tashiro M., Vichot G., Whatley H.E., Wieczorek A., Wieczorek M. Biochemistry 26:202-221(1987)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share