Recombinant Chlamydia trachomatis Large cysteine-rich periplasmic protein OmcB(omcB),partial

Recombinant Chlamydia trachomatis Large cysteine-rich periplasmic protein OmcB(omcB),partial

CSB-EP315528DSB
Regular price
£663.00 GBP
Sale price
£663.00 GBP
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170405

Research areas: Microbiology

Target / Protein: omcB

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Chlamydia trachomatis (strain D/UW-3/Cx)

Delivery time: 3-7 business days

Uniprot ID: P0CC04

AA Sequence: LADTKAKDNTSHKSKKARKNHSKETPVDRKEVAPVHESKATGPKQDSCFGRMYTVKVNDDRNVEITQAVPEYATVGSPYPIEITATGKRDCVDVIITQQLPCEAEFVRSDPATTPTADGKLVWKIDRLGQGEKSKITVWVKPLKEGCCFTAATVCA

Tag info: N-terminal 6xHis-SUMO-tagged

Expression Region: 41-196aa

Protein length: Partial

MW: 33.1 kDa

Alternative Name(s): Large-CRP Alternative name(s): 60 kDa cysteine-rich OMP 60 kDa outer membrane protein Cysteine-rich outer membrane protein Short name: CRP

Relevance: In elementary bodies (EBs, the infectious stage, which is able to survive outside the host cell) provides the structural integrity of the outer envelope through disulfide cross-links with the small cysteine-rich protein and the major outer membrane protein. It has been described in publications as the Sarkosyl-insoluble COMC (Chlamydia outer membrane complex), and serves as the functional equivalent of peptidoglycan.

Reference: "Genome sequence of an obligate intracellular pathogen of humans: Chlamydia trachomatis."Stephens R.S., Kalman S., Lammel C.J., Fan J., Marathe R., Aravind L., Mitchell W.P., Olinger L., Tatusov R.L., Zhao Q., Koonin E.V., Davis R.W.Science 282:754-759(1998).

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share