Recombinant Centruroides suffusus suffusu Beta-mammal toxin Css4

Recombinant Centruroides suffusus suffusu Beta-mammal toxin Css4

CSB-EP350214DRC
Regular price
£651.00 GBP
Sale price
£651.00 GBP
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170405

Research areas: Others

Target / Protein:

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Centruroides suffusus suffusus (Mexican scorpion)

Delivery time: 3-7 business days

Uniprot ID: P60266

AA Sequence: KEGYLVNSYTGCKFECFKLGDNDYCLRECRQQYGKGSGGYCYAFGCWCTHLYEQAVVWPLPNKTCN

Tag info: N-terminal 6xHis-SUMO-tagged

Expression Region: 1-66aa

Protein length: Full Length

MW: 23.6 kDa

Alternative Name(s):

Relevance: Beta toxins bind voltage-independently at site-4 of sodium channels (Nav) and shift the voltage of activation toward more negative potentials thereby affecting sodium channel activation and promoting spontaneous and repetitive firing. This toxin is active only on mammals.

Reference: Neutralization of gating charges in domain II of the sodium channel alpha subunit enhances voltage-sensor trapping by a beta-scorpion toxin.Cestele S., Scheuer T., Mantegazza M., Rochat H., Catterall W.A.J. Gen. Physiol. 118:291-302(2001)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share