>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20170405
Research areas: Others
Target / Protein:
Biologically active: Not Tested
Expression system: E.coli
Species of origin: Centruroides suffusus suffusus (Mexican scorpion)
Delivery time: 3-7 business days
Uniprot ID: P60266
AA Sequence: KEGYLVNSYTGCKFECFKLGDNDYCLRECRQQYGKGSGGYCYAFGCWCTHLYEQAVVWPLPNKTCN
Tag info: N-terminal 6xHis-SUMO-tagged
Expression Region: 1-66aa
Protein length: Full Length
MW: 23.6 kDa
Alternative Name(s):
Relevance: Beta toxins bind voltage-independently at site-4 of sodium channels (Nav) and shift the voltage of activation toward more negative potentials thereby affecting sodium channel activation and promoting spontaneous and repetitive firing. This toxin is active only on mammals.
Reference: Neutralization of gating charges in domain II of the sodium channel alpha subunit enhances voltage-sensor trapping by a beta-scorpion toxin.Cestele S., Scheuer T., Mantegazza M., Rochat H., Catterall W.A.J. Gen. Physiol. 118:291-302(2001)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.