Recombinant Calloselasma rhodostoma Snaclec rhodocytin subunit alpha

Recombinant Calloselasma rhodostoma Snaclec rhodocytin subunit alpha

CSB-EP888242CBG
Regular price
£639.00 GBP
Sale price
£639.00 GBP
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170405

Research areas: Others

Target / Protein:

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Calloselasma rhodostoma (Malayan pit viper) (Agkistrodon rhodostoma)

Delivery time: 3-7 business days

Uniprot ID: Q9I841

AA Sequence: GLEDCDFGWSPYDQHCYQAFNEQKTWDEAEKFCRAQENGAHLASIESNGEADFVSWLISQKDELADEDYVWIGLRAQNKEQQCSSEWSDGSSVSYENLIDLHTKKCGALEKLTGFRKWVNYYCEQMHAFVCKLLPY

Tag info: N-terminal 6xHis-SUMO-tagged

Expression Region: 1-136aa

Protein length: Full Length

MW: 31.8 kDa

Alternative Name(s): Aggretin alpha chain Rhodoaggretin subunit alpha

Relevance: Elicits platelet aggregation by the binding to the C-type lectin domain family 1 member B (CLEC1B/CLEC2). Binding leads to tyrosine phosphorylation in the Cytoplasmic domain tail of CLEC1B, which promotes the binding of spleen tyrosine kinase (Syk), subsequent activation of PLC-gamma-2, and platelet activation and aggregation. Binding to GPIbalpha (GP1BA) and alpha-2/beta-1 (ITGA2/ITGB1) may also induce aggregation, but this is controversial.

Reference: "Aggretin, a heterodimeric C-type lectin from Calloselasma rhodostoma (malayan pit viper), stimulates platelets by binding to alpha 2beta 1 integrin and glycoprotein Ib, activating Syk and phospholipase Cgamma 2, but does not involve the glycoprotein VI/Fc receptor gamma chain collagen receptor."Navdaev A., Clemetson J.M., Polgar J., Kehrel B.E., Glauner M., Magnenat E., Wells T.N.C., Clemetson K.J.J. Biol. Chem. 276:20882-20889(2001).

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

You may also like

  • Recombinant Calloselasma rhodostoma Snaclec rhodocytin subunit alpha
    Regular price
    £639.00 GBP
    Sale price
    £639.00 GBP
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Calloselasma rhodostoma Rhodocytin subunit beta
    Regular price
    £639.00 GBP
    Sale price
    £639.00 GBP
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Calloselasma rhodostoma Snaclec rhodocytin subunit alpha
    Regular price
    £701.00 GBP
    Sale price
    £701.00 GBP
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Calloselasma rhodostoma Snaclec rhodocytin subunit beta
    Regular price
    £701.00 GBP
    Sale price
    £701.00 GBP
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share