Recombinant Bovine Serpin A3-5(SERPINA3-5)

Recombinant Bovine Serpin A3-5(SERPINA3-5)

CSB-YP382675BO
Regular price
£732.00 GBP
Sale price
£732.00 GBP
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:100ug. Other sizes are also available. For further information, please contact us.

Research Areas:Others

Uniprot ID:A2I7N1

Gene Names:SERPINA3-5

Organism:Bos taurus (Bovine)

AA Sequence:LPENVVVKDQRRRVDSHTLASSNTDFAFSLYKQLALKNPNKNVMFSPLSVSMALAFLSLGARGPTLTEILEGLKFNLTEIQETQIHQGFQHLLQALNRPSNQLQLSVGNAMFVQEELKLLDKFIEDARVLYSSEAFPTNFRDSEAARSLINDYVKNKTQGKIEELFKYLSPRTVLVLVNYIYFKAQWKTRFDPKHTEQAEFHVSKNKTVEVPMMTLDLETPYFRDKELGCMLVELTYSSNDSALFILPDEGKMQDLEAKLTPETLTRWRNSLQPRRIHELYLPKFSIKSNYELNDTLSQMGIKKIFTDADLSGITGTADLVVSQVVHGAALDVDEEGTEGAAATGIGIERTFLRIIVRVNRPFLIAVVLKDTQSIIFLGKVTNPSEA

Expression Region:25-411aa

Sequence Info:Full Length of Mature Protein

Source:Yeast

Tag Info:N-terminal 10xHis-tagged and C-terminal Myc-tagged

MW:47.8 kDa

Alternative Name(s):SERPINA3-5; Serpin A3-5

Relevance:Serine protease inhibitor.

Reference:"An original SERPINA3 gene cluster: elucidation of genomic organization and gene expression in the Bos taurus 21q24 region." Pelissier P., Delourme D., Germot A., Blanchet X., Becila S., Maftah A., Leveziel H., Ouali A., Bremaud L. BMC Genomics 9:151-151(2008)

Purity:Greater than 90% as determined by SDS-PAGE.

Form:Liquid or Lyophilized powder

Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:Serine protease inhibitor.

Involvement in disease:

Subcellular Location:Cytoplasmic vesicle, secretory vesicle, chromaffin granule, Secreted

Protein Families:Serpin family

Tissue Specificity:

Paythway:

HGNC Database Link:

UniGene Database Link:https://www.ncbi.nlm.nih.gov/UniGene/clust.cgi?ORG=Bt&CID=55387

KEGG Database Link:https://www.genome.jp/dbget-bin/www_bget?bta:617667

STRING Database Link:https://string-db.org/network/9913.ENSBTAP00000009264

OMIM Database Link:

Lead Time Guidance:25-35 business days

Your list is ready to share