Recombinant Bovine Resistin(RETN)

Recombinant Bovine Resistin(RETN)

CSB-EP019573BO
Regular price
£659.00 GBP
Sale price
£659.00 GBP
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170405

Research areas: Others

Target / Protein: RETN

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Bos taurus (Bovine)

Delivery time: 3-7 business days

Uniprot ID: Q762I5

AA Sequence: QSLCPIDKAISEKIQEVTTSLVPGAVRIIGLDCRSVTSRGSLVTCPSGFAVTGCTCGSACGSWDVRAETTCHCQCAGMDWTGARCCRLHIQ

Tag info: N-terminal 6xHis-tagged

Expression Region: 19-109aa

Protein length: Full Length

MW: 13.6 kDa

Alternative Name(s):

Relevance: Hormone that ses to suppress insulin ability to stimulate glucose uptake into adipose cells. Potentially links obesity to diabetes .

Reference: Gene expression of resistin and TNF-alpha in adipose tissue of Japanese Black steers and Holstein steers.Komatsu T., Itoh F., Hodate K., Hazegawa S., Obara Y., Kushibiki S.Anim. Sci. J. 76:567-573(2005)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share