
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Others
Uniprot ID: O51698
Gene Names: clpP2
Organism: Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680)
AA Sequence: MTGKEDNDACVLHDKSLKLVLKSRSIVIAGEITKDVSRLFQEKILLLEALDFKKPIFVYIDSEGGDIDAGFAIFNMIRFVKPKVFTVGVGLVASAAALIFLAAKLENRFSLPFARYLLHQPLSGFKGVATDIEIYTNELNKVKKELNNIISKETGQKISKIEKDTDRDFWLDSSAAKKYGLVFEVVETKYQLEEFISA
Expression Region: 1-198aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
MW: 42.2 kDa
Alternative Name(s): Endopeptidase Clp 2
Relevance: Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.
Reference: "Genomic sequence of a Lyme disease spirochaete, Borrelia burgdorferi." Fraser C.M., Casjens S., Huang W.M., Sutton G.G., Clayton R.A., Lathigra R., White O., Ketchum K.A., Dodson R.J., Hickey E.K., Gwinn M.L., Dougherty B.A., Tomb J.-F., Fleischmann R.D., Richardson D.L., Peterson J.D., Kerlavage A.R., Quackenbush J. Venter J.C. Nature 390:580-586(1997)
Purity: Greater than 85% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Borrelia burgdorferi ATP-dependent Clp protease proteolytic subunit 2(clpP2)
- Regular price
- £630.00 GBP
- Sale price
- £630.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Borrelia burgdorferi ATP-dependent Clp protease proteolytic subunit 2(clpP2)
- Regular price
- £630.00 GBP
- Sale price
- £630.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Borrelia burgdorferi Outer surface protein A(ospA)
- Regular price
- £536.00 GBP
- Sale price
- £536.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Borrelia burgdorferi Uncharacterized protein BB_0039 (BB_0039)
- Regular price
- £1,101.00 GBP
- Sale price
- £1,101.00 GBP
- Regular price
-
- Unit price
- per
Sold out