Recombinant Bacillus subtilis Uncharacterized protein yphE(yphE)

CSB-CF343879BRJ

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bacillus subtilis (strain 168)

Uniprot NO.:P50744

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNLALMKMWFALGSMGLMFLAVASIYLSRFKCQNRFLKIAISSFAYMCMLISGIIVFVVV FSGPVNE

Protein Names:Recommended name: Uncharacterized protein yphE

Gene Names:Name:yphE Ordered Locus Names:BSU22820

Expression Region:1-67

Sequence Info:full length protein