Size:100ug. Other sizes are also available. For further information, please contact us.
Research Areas:Signal Transduction
Uniprot ID:O07623
Gene Names:sboA
Organism:Bacillus subtilis (strain 168)
AA Sequence:NKGCATCSIGAACLVDGPIPDFEIAGATGLFGLWG
Expression Region:9-43aa
Sequence Info:Full Length of Mature Protein
Source:E.coli
Tag Info:Tag-Free
MW:3.4 kDa
Alternative Name(s):Antilisterial bacteriocin subtilosin (sbo)
Relevance:Has bacteriocidal activity against some Gram-positive bacteria such as Listeria, some species of Bacillus and E.faecium, A single mutation (Thr-14-Ile) confers hemolytic activity against rabbit and human blood
Reference:"Subtilosin A, a new antibiotic peptide produced by Bacillus subtilis 168: isolation, structural analysis, and biogenesis." Babasaki K., Takao T., Shimonishi Y., Kurahashi K. J. Biochem. 98:585-603(1985)
Purity:Greater than 90% as determined by SDS-PAGE.
Form:Liquid or Lyophilized powder
Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function:Has bacteriocidal activity against some Gram-positive bacteria such as Listeria, some species of Bacillus and E.faecium
Involvement in disease:
Subcellular Location:Secreted
Protein Families:Bacteriocin class V family
Tissue Specificity:
Paythway:
HGNC Database Link:
UniGene Database Link:
KEGG Database Link:https://www.genome.jp/dbget-bin/www_bget?bsu:BSU37350
STRING Database Link:https://string-db.org/network/224308.Bsubs1_010100020186
OMIM Database Link:
Lead Time Guidance:13-23 business days