Recombinant Avena sativa Endochitinase

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Avena sativa Endochitinase

CSB-EP308852DPO
Regular price
£554.00 GBP
Sale price
£554.00 GBP
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20171018

Research areas: Others

Target / Protein: N/A

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Avena sativa (Oat)

Delivery time: 3-7 business days

Uniprot ID: P86181

AA Sequence: VSSVISSSLFEKMLLHRGFYTYDAFIAAAKSFPAFATTGSTDVRKREVAAFLAQTSHETTGGWPTAPDGPYELGSTSDYFGRGPIQISYNYNYGAAGKAIGVDLLRNPDLVTSDNTVEFKTALWFWMTPQSPKPSSHDVITGRWSPSSTDKAAGRVPGYGVLTNIIDGGVECGKGQESHVADRIGYYKDNLDCYNQKPFA

Tag info: N-terminal 6xHis-tagged

Expression Region: 1-200aa

Protein length: Full Length

MW: 25.7 kDa

Alternative Name(s):

Relevance: This protein functions as a defense against chitin-containing fungal pathogens.

Reference: "Oat (Avena sativa) seed extract as an antifungal food preservative through the catalytic activity of a highly abundant class I chitinase." Sorensen H.P., Madsen L.S., Petersen J., Andersen J.T., Hansen A.M., Beck H.C. Appl. Biochem. Biotechnol. 160:1573-1584(2010)

Purity: Greater than 85% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share