
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Others
Uniprot ID: P19400
Gene Names: N/A
Organism: Ascaris suum (Pig roundworm) (Ascaris lumbricoides)
AA Sequence: QFLFSMSTGPFICTVKDNQVFVANLPWTMLEGDDIQVGKEFAARVEDCTNVKHDMAPTCTKPPPFCGPQDMKMFNFVGCSVLGNKLFIDQKYVRDLTAKDHAEVQTFREKIAAFEEQQENQPPSSGMPHGAVPAGGLSPPPPPSFCTVQ
Expression Region: 21-169aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
MW: 32.4 kDa
Alternative Name(s): Short name: PI-3
Relevance: This is an inhibitor of the aspartic protease pepsin.
Reference: "Molecular cloning, expression and characterization of an Ascaris inhibitor for pepsin and cathepsin E."Kageyama T.Eur. J. Biochem. 253:804-809(1998)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Mouse Serine protease inhibitor A3N(Serpina3n)
- Regular price
- £538.00 GBP
- Sale price
- £538.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Pig Protegrin-3(NPG3)
- Regular price
- £632.00 GBP
- Sale price
- £632.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Mouse Serine protease inhibitor A3N(Serpina3n)
- Regular price
- £536.00 GBP
- Sale price
- £536.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Serpin B4(SERPINB4)
- Regular price
- £538.00 GBP
- Sale price
- £538.00 GBP
- Regular price
-
- Unit price
- per
Sold out