Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Artemia salina (Brine shrimp)
Uniprot NO.:P19046
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:LFVLLWLTFTTQSFILFYVFFECSLIPTIILILGWGYQPERLPASYYFLFYTLLSSLPLL FIIMLTRVFIR
Protein Names:Recommended name: NADH-ubiquinone oxidoreductase chain 4 EC= 1.6.5.3 Alternative name(s): NADH dehydrogenase subunit 4
Gene Names:Name:ND4
Expression Region:1-71
Sequence Info:full length protein
You may also like
-
Recombinant Artemia salina NADH-ubiquinone oxidoreductase chain 4L(ND4L)
- Regular price
- £887.00 GBP
- Sale price
- £887.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Artemia salina NADH-ubiquinone oxidoreductase chain 1(ND1)
- Regular price
- £915.00 GBP
- Sale price
- £915.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Artemia salina NADH-ubiquinone oxidoreductase chain 3(ND3)
- Regular price
- £876.00 GBP
- Sale price
- £876.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Artemia salina NADH-ubiquinone oxidoreductase chain 2(ND2)
- Regular price
- £920.00 GBP
- Sale price
- £920.00 GBP
- Regular price
-
- Unit price
- per
Sold out