
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 22-32 working days
Research Topic: Immunology
Uniprot ID: Q8GY79
Gene Names: DRB5
Organism: Arabidopsis thaliana (Mouse-ear cress)
AA Sequence: MYKNQLQELAQRSCFNLPSYTCIREGPDHAPRFKASVNFNGEIFESPTYCSTLRQAEHAAAEVSLNVLSSRVPSKSLTAKILDETGIYKNLLQETAHRAGLDLPMYTSVRSGSCHFPGFSCTVELAGMTFTGESAKTKKQAEKNAAIAAWSSLKKMSSLDSQDEEKEQEAVARVLSRFKPKEVRRRETTNQWRRRTSQQDSNKDLLIERLRWINLLTNQASSSSSTSTPNQHKNSSFISLIPPPPPPKSSKILPFIQQYKDRSSQEAKTETATEMINSKAKVNETSTRLSKQMPFSDMNRYNFVGGCSVNPYSLAPAVQMRSVIPVFAAPPPKPNPNLNPSSLSSSVNEFTSSNNSCSVLNTPGLGGQEKKNLTREMIKLGSESRILDQTHDS
Expression Region: 1-393aa
Sequence Info: Full Length
Source: Yeast
Tag Info: N-terminal 6xHis-tagged
MW: 45.6 kDa
Alternative Name(s): dsRNA-binding protein 5 Short name: AtDRB5
Relevance: Binds double-stranded RNA. May be involved in RNA-mediated silencing.
Reference: "Structural analysis of Arabidopsis thaliana chromosome 5. IV. Sequence features of the regions of 1,456,315 bp covered by nineteen physically assigned P1 and TAC clones."Sato S., Kaneko T., Kotani H., Nakamura Y., Asamizu E., Miyajima N., Tabata S.DNA Res. 5:41-54(1998)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Arabidopsis thaliana Dehydration-responsive element-binding protein 2C(DREB2C)
- Regular price
- £618.00 GBP
- Sale price
- £618.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Arabidopsis thaliana Trihelix transcription factor GT-1(GT-1)
- Regular price
- £629.00 GBP
- Sale price
- £629.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Arabidopsis thaliana Trihelix transcription factor GT-1(GT-1)
- Regular price
- £690.00 GBP
- Sale price
- £690.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Arabidopsis thaliana At1g09870/F21M12_26(At1g09870)
- Regular price
- £618.00 GBP
- Sale price
- £618.00 GBP
- Regular price
-
- Unit price
- per
Sold out