
>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20170405
Research areas: Microbiology
Target / Protein: afp
Biologically active: Not Tested
Expression system: E.coli
Species of origin: Aspergillus giganteus
Delivery time: 3-7 business days
Uniprot ID: P17737
AA Sequence: ATYNGKCYKKDNICKYKAQSGKTAICKCYVKKCPRDGAKCEFDSYKGKCYC
Tag info: N-terminal 6xHis-B2M-tagged
Expression Region: 44-94aa
Protein length: Full Length
MW: 19.8 kDa
Alternative Name(s):
Relevance: This protein inhibits the growth of a variety of fungal species.
Reference: "NMR solution structure of the antifungal protein from Aspergillus giganteus: evidence for cysteine pairing isomerism."Campos-Olivas R., Bruix M., Santoro J., Lacadena J., Martinez del Pozo A., Gavilanes J.G., Rico M.Biochemistry 34:3009-3021(1995) .
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.