Recombinant Actinoplanes utahensis Aculeacin-A acylase(aac) ,partial

Recombinant Actinoplanes utahensis Aculeacin-A acylase(aac) ,partial

CSB-EP333489ACY
Regular price
£659.00 GBP
Sale price
£659.00 GBP
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170725

Research areas: Others

Target / Protein: aac

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Actinoplanes utahensis

Delivery time: 3-7 business days

Uniprot ID: P29958

AA Sequence: GGYAALIRRASYGVPHITADDFGSLGFGVGYVQAEDNICVIAESVVTANGERSRWFGATGPDDADVRTTSSTQAIDDRVAERLLEGPRDGVRAPCDDVRDQMRGFVAGYNHFLRRTGVHRLTDPACRGKAWVRPLSEIDLWRTSWDSMVRAGSGALLDGIVAATPPTAAGPASAPEAPDA

Tag info: N-terminal 6xHis-SUMO-tagged

Expression Region: 35-214aa

Protein length: Partial

MW: 35.1 kDa

Alternative Name(s): Aculeacin-A acylase small subunit Aculeacin-A acylase large subunit

Relevance: Catalyzes the hydrolysis of the palmitoyl moiety of the antifungal antibiotic, aculeacin-A, giving a hexapeptide moiety and a long chain fatty acid.

Reference: "Cloning and sequencing of the aculeacin A acylase-encoding gene from Actinoplanes utahensis and expression in Streptomyces lividans." Inokoshi J., Takeshima H., Ikeda H., Omura S.Gene 119:29-35(1992)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share