Recombinant Human Myeloid cell surface antigen CD33(CD33),partial (Active)

Recombinant Human Myeloid cell surface antigen CD33(CD33),partial (Active)

CSB-MP004925HU
Regular price
€278,95 EUR
Sale price
€278,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

Size:100ug. Other sizes are also available. Please contact us.

Research Areas:Cancer

Uniprot NO.:P20138

Uniprot Entry Name:

Gene Names:CD33

Species:Homo sapiens (Human)

Source:Mammalian cell

Expression Region:18-259aa

Sequence:DPNFWLQVQESVTVQEGLCVLVPCTFFHPIPYYDKNSPVHGYWFREGAIISRDSPVATNKLDQEVQEETQGRFRLLGDPSRNNCSLSIVDARRRDNGSYFFRMERGSTKYSYKSPQLSVHVTDLTHRPKILIPGTLEPGHSKNLTCSVSWACEQGTPPIFSWLSAAPTSLGPRTTHSSVLIITPRPQDHGTNLTCQVKFAGAGVTTERTIQLNVTYVPQNPTTGIFPGDGSGKQETRAGVVH

Protein Description:Partial

Tag Info:C-terminal hFc-Myc-tagged

Mol. Weight:56.9 kDa

Biological_Activity:Measured by its binding ability in a functional ELISA. Immobilized CD33 at 2 ?g/ml can bind Anti-CD33 rabbit monoclonal antibody, the EC50 of human CD33 protein is 4.289- 5.312 ng/ml.

Purity:Greater than 95% as determined by SDS-PAGE.

Endotoxin:Less than 1.0 EU/ug as determined by LAL method.

Form:Lyophilized powder

Buffer:Lyophilized from a 0.2 ?m filtered PBS, 6% Trehalose, pH 7.4

Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Alternative Name/ Alias:Sialic acid-binding Ig-like lectin 3 (Siglec-3) (gp67) (CD33) (SIGLEC3)

Relevance:Sialic-acid-binding immunoglobulin-like lectin that plays a role in mediating cell-cell interactions and in maintaining immune cells in a resting state . Preferentially recognizes and binds alpha-2,3- and more avidly alpha-2,6-linked sialic acid-bearing glycans . Upon engagement of ligands such as C1q or syalylated glycoproteins, two immunoreceptor tyrosine-based inhibitory motifs located in CD33 cytoplasmic tail are phosphorylated by Src-like kinases such as LCK . These phosphorylations provide docking sites for the recruitment and activation of protein-tyrosine phosphatases PTPN6/SHP-1 and PTPN11/SHP-2 . In turn, these phosphatases regulate downstream pathways through dephosphorylation of signaling molecules . One of the repressive effect of CD33 on monocyte activation requires phosphoinositide 3-kinase/PI3K .

PubMed ID:

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

HGNC Database Link:

UniGene Database Link:

KEGG Database Link:

STRING Database Link:

OMIM Database Link:

You may also like

  • Recombinant Human CD276 antigen(CD276),partial (Active)
    Regular price
    €327,95 EUR
    Sale price
    €327,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human T-cell antigen CD7(CD7),partial (Active)
    Regular price
    €367,95 EUR
    Sale price
    €367,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Myeloid cell surface antigen CD33(CD33)
    Regular price
    €1.201,95 EUR
    Sale price
    €1.201,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human CD226 antigen(CD226),partial (Active)
    Regular price
    €367,95 EUR
    Sale price
    €367,95 EUR
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share