Recombinant Zaire ebolavirus Nucleoprotein(NP),partial

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Zaire ebolavirus Nucleoprotein(NP),partial

CSB-EP323576ZABa2
Regular price
¥109,400 JPY
Sale price
¥109,400 JPY
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20171018

Research areas: Microbiology

Target / Protein: NP

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Zaire ebolavirus (strain Mayinga-76) (ZEBOV) (Zaire Ebola virus)

Delivery time: 3-7 business days

Uniprot ID: P18272

AA Sequence: LDEDDEDTKPVPNRSTKGGQQKNSQKGQHIEGRQTQSRPIQNVPGPHRTIHHASAPLTDNDRRNEPSGSTSPRMLTPINEEADPLDDADDETSSLPPLESDDEEQDRDGTSNRTPTVAPPAPVYRDHSEKKELPQDEQQDQDHTQEARNQDSDNTQSEHSFEEMYRHILRSQGPFDAVLYYHMMKDEPVVFSTSDGKEYTYPDSLEEEYPPWLTEKEAMNEENRFVTLDGQQFYWPVMNHKNKFMAILQHHQ

Tag info: N-terminal 6xHis-SUMO-tagged

Expression Region: 488-739aa

Protein length: Partial

MW: 45.1 kDa

Alternative Name(s): Nucleocapsid protein

Relevance: Encapsidates the genome, protecting it from nucleases. The encapsidated genomic RNA is termed the nucleocapsid and serves as template for transcription and replication. During replication, encapsidation by NP is coupled to RNA synthesis and all replicative products are resistant to nucleases.

Reference: "The assembly of Ebola virus nucleocapsid requires virion-associated proteins 35 and 24 and posttranslational modification of nucleoprotein." Huang Y., Xu L., Sun Y., Nabel G.J. Mol. Cell 10:307-316(2002)

Purity: Greater than 85% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share