
>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20171018
Research areas: Others
Target / Protein: NP
Biologically active: Not Tested
Expression system: E.coli
Species of origin: Zaire ebolavirus (strain Mayinga-76) (ZEBOV) (Zaire Ebola virus)
Delivery time: 3-7 business days
Uniprot ID: P18272
AA Sequence: LDEDDEDTKPVPNRSTKGGQQKNSQKGQHIEGRQTQSRPIQNVPGPHRTIHHASAPLTDNDRRNEPSGSTSPRMLTPINEEADPLDDADDETSSLPPLESDDEEQDRDGTSNRTPTVAPPAPVYRDHSEKKELPQDEQQDQDHTQEARNQDSDNTQSEHSFEEMYRHILRSQGPFDAVLYYHMMKDEPVVFSTSDGKEYTYPDSLEEEYPPWLTEKEAMNEENRFVTLDGQQFYWPVMNHKNKFMAILQHHQ
Tag info: N-terminal 6xHis-tagged
Expression Region: 488-739aa
Protein length: Partial
MW: 33.1 kDa
Alternative Name(s): Nucleocapsid protein ;Protein N
Relevance: Encapsidates the genome, protecting it from nucleases. The encapsidated genomic RNA is termed the nucleocapsid and serves as tplate for transcription and replication. During replication, encapsidation by NP is coupled to RNA synthesis and all replicative products are resistant to nucleases.
Reference: Mapping of the VP40-binding regions of the nucleoprotein of Ebola virus.Noda T., Watanabe S., Sagara H., Kawaoka Y.J. Virol. 81:3554-3562(2007)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Zaire ebolavirus Nucleoprotein(NP),partial
- Regular price
- ¥102,300 JPY
- Sale price
- ¥102,300 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Zaire ebolavirus Nucleoprotein(NP),partial
- Regular price
- ¥132,000 JPY
- Sale price
- ¥132,000 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Zaire ebolavirus Nucleoprotein(NP),partial
- Regular price
- ¥102,300 JPY
- Sale price
- ¥102,300 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Zaire ebolavirus Nucleoprotein(NP),partial
- Regular price
- ¥131,900 JPY
- Sale price
- ¥131,900 JPY
- Regular price
-
- Unit price
- per
Sold out