Recombinant Yersinia enterocolitica Outer membrane virulence protein YopE(yopE)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Yersinia enterocolitica Outer membrane virulence protein YopE(yopE)

CSB-CF330087YQA
Regular price
¥130,100 JPY
Sale price
¥130,100 JPY
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 10ug

Updated Date: Stock Protein updated on 20171228

Research areas: Others

Target / Protein: yopE

Biologically active: Not Tested

Expression system: in vitro E.coli expression system

Species of origin: Yersinia enterocolitica

Delivery time: 3-7 business days

Uniprot ID: P31492

AA Sequence: MKISSFISTSLPLPASVSGSSSVGEMSGRSVSQQKSDQYANNLAGRTESPQGSSLASRIIERLSSMAHSVIGFIQRMFSEGSHKPVVTPALTPAQMPSPTSFSDSIKQLAAETLPKYMQQLSSLDAETLQKNHDQFATGSGPLRGSITQCQGLMQFCGGELQAEASAILNTPVCGIPFSQWGTVGGAASAYVASGVDLTQAANEIKGLGQQMQQLLSLM

Tag info: N-terminal 6xHis-tagged

Expression Region: 1-219aa

Protein length: Full Length

MW: 26.9 kDa

Alternative Name(s):

Relevance: Essential virulence determinant; cytotoxic effector, involved in resistance to phagocytosis

Reference: "Secretion of Yop proteins by Yersiniae."Michiels T., Wattiau P., Brasseur R., Ruysschaert J.M., Cornelis G.Infect. Immun. 58:2840-2849(1990)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share