>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20171228
Research areas: Others
Target / Protein: p
Biologically active: Not Tested
Expression system: E.coli
Species of origin: Vesicular stomatitis Indiana virus (strain Mudd-Summers) (VSIV)
Delivery time: 3-7 business days
Uniprot ID: Q86132
AA Sequence: MRSKHNELKSPIMSCSKRTEWKSILGPLIFRQQMILTQNLNQKLKTIKACMYQIRKLSKLKALYRGL
Tag info: N-terminal 6xHis-tagged
Expression Region: 1-67aa
Protein length: Full Length
MW: 11.9 kDa
Alternative Name(s):
Relevance: May play a role in viral pathogenesis or transmission by insects vectors.
Reference: "Cloning and expression of a viral phosphoprotein: structure suggests vesicular stomatitis virus NS may function by mimicking an RNA template." Hudson L.D., Condra C., Lazzarini R.A. J. Gen. Virol. 67:1571-1579(1986)
Purity: Greater than 85% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.