>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20170405
Research areas: Others
Target / Protein: PRF
Biologically active: Not Tested
Expression system: Yeast
Species of origin: Infectious bronchitis virus
Delivery time: 3-7 business days
Uniprot ID: Q58NA1
AA Sequence: SDWDPVVKEWLVDTGYCCAGGIANAEDGVVFAAAADDDDGWSKLYKDDHEEDTIGEDGNACGKVSINEASTIKAAVDDGSAPNGVWIGGQKYKVVRPEKGFEYNDCTFDITMCARSKGGAHLIKTPNGSIVIALYDEEKEQDKGNSRTSALAFAEYLHQSGY
Tag info: N-terminal 6xHis-tagged
Expression Region: 2-163aa
Protein length: Full Length
MW: 19.4 kDa
Alternative Name(s):
Relevance:
Reference: A profilin-like protein from Toxoplasma gondii potently triggers dendritic cell IL-12 production through TLR11.Yarovinsky F., Zhang D., Andersen J.F., Bannenberg G.L., Serhan C.N., Hayden M.S., Hieny S., Sutterwala F., Flavell R.A., Ghosh S., Sher A.Skillman K.M., Sibley D. Common inheritance of chromosome Ia associated with clonal expansion of Toxoplasma gondii.Khan A., Bohme U., Kelly K.A., Adlem E., Brooks K., Simmonds M., Mungall K., Quail M.A., Arrowsmith C., Chillingworth T., Churcher C., Harris D., Collins M., Fosker N., Fraser A., Hance Z., Jagels K., Moule S. , Murphy L., O'Neil S., Rajandream M.A., Saunders D., Seeger K., Whitehead S., Mayr T., Xuan X., Watanabe J., Suzuki Y., Wakaguri H., Sugano S., Sugimoto C., Paulsen I., Mackey A.J., Roos D.S., Hall N., Berriman M., Barrell B., Sibley L.D., Ajioka J.W.Genome Res. 16:1119-1125(2006)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.