Recombinant Torpedo californica Acetylcholine receptor subunit alpha(CHRNA1),partial

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Torpedo californica Acetylcholine receptor subunit alpha(CHRNA1),partial

CSB-EP005386TOTa2
Regular price
¥128,600 JPY
Sale price
¥128,600 JPY
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170725

Research areas: Others

Target / Protein: CHRNA1

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Tetronarce californica (Pacific electric ray) (Torpedo californica)

Delivery time: 3-7 business days

Uniprot ID: P02710

AA Sequence: SEHETRLVANLLENYNKVIRPVEHHTHFVDITVGLQLIQLISVDEVNQIVETNVRLRQQWIDVRLRWNPADYGGIKKIRLPSDDVWLPDLVLYNNADGDFAIVHMTKLLLDYTGKIMWTPPAIFKSYCEIIVTHFPFDQQNCTMKLGIWTYDGTKVSISPESDRPDLSTFMESGEWVMKDYRGWKHWVYYTCCPDTPYLDITYHFIMQRI

Tag info: N-terminal 6xHis-SUMO-tagged

Expression Region: 25-234aa

Protein length: Extracellular Domain

MW: 40.8 kDa

Alternative Name(s):

Relevance: After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane.

Reference: "Identifying the lipid-protein interface of the Torpedo nicotinic acetylcholine receptor: secondary structure implications." Blanton M.P., Cohen J.B.Biochemistry 33:2859-2872(1994)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share