Recombinant Sulfolobus islandicus Chromatin protein Cren7(creN7)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Sulfolobus islandicus Chromatin protein Cren7(creN7)

CSB-EP502491FPB
Regular price
¥128,500 JPY
Sale price
¥128,500 JPY
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: C3MPN0

Gene Names: creN7

Organism: Sulfolobus islandicus (strain L.S.2.15 / Lassen #1)

AA Sequence: MSSGKKAVKVKTPAGKEAELVPEKVWALAPKGRKGVKIGLFKDPETGKYFRHKLPDDYPI

Expression Region: 1-60aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal GST-tagged

MW: 33.6 kDa

Alternative Name(s):

Relevance: A probable chromatin protein, binds double-strand DNA without sequence specificity. Constrains negative DNA supercoils.

Reference: Biogeography of the Sulfolobus islandicus pan-genome.Reno M.L., Held N.L., Fields C.J., Burke P.V., Whitaker R.J.Proc. Natl. Acad. Sci. U.S.A. 106:8605-8610(2009)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share