Recombinant Silene chalcedonica Ribosome-inactivating protein lychnin

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Silene chalcedonica Ribosome-inactivating protein lychnin

CSB-EP307648LKN
Regular price
¥129,100 JPY
Sale price
¥129,100 JPY
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: P85101

Gene Names: N/A

Organism: Silene chalcedonica (Maltese-cross) (Lychnis chalcedonica)

AA Sequence: RPSWTVDSDSAKYSSFLDSLREEFGRGTPKVCNIPVTKKANNDKFVLVNLVLPFNRNTITLAFRASDAYLVGFQDRDSKTNKLRANFFSDEYRALSGKYKSIFTDAEVLAPALPCASTYTDLQNKAGVSREKLSLGVSSLQTAFTAVYGKVFTGKNVAKFALISIQMVAEAARFKYIEDQVINRGMYSSFEAGARITLLENNWSKISEQYHKSCKLGGGQFTEEEMKLGLLLYN

Expression Region: 1-234aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

MW: 30.1 kDa

Alternative Name(s):

Relevance: Ribosome-inactivating protein of type 1, inhibits protein synthesis in animal cells. Inhibits cell-free translation in rabbit reticulocyte lysate system with an IC50 of 0.17 nM.

Reference: "Sequence determination of lychnin, a type 1 ribosome-inactivating protein from Lychnis chalcedonica seeds." Chambery A., de Donato A., Bolognesi A., Polito L., Stirpe F., Parente A. Biol. Chem. 387:1261-1266(2006)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share