
>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20170405
Research areas: Signal Transduction
Target / Protein: adk
Biologically active: Not Tested
Expression system: E.coli
Species of origin: Shigella flexneri
Delivery time: 3-7 business days
Uniprot ID: Q83M40
AA Sequence: MRIILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSGSELGKQAKDIMDAGKLVTDELVIALVKERIAQEDCRNGFLLDGFPRTIPQADAMKEAGINVDYVLEFDVPDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRKDDQEETVRKRLVEYHQMTAPLIGYYSKEAEAGNTKYAKVDGTKQVAEVRADLEKILG
Tag info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Expression Region: 1-214aa
Protein length: Full Length
MW: 43.6 kDa
Alternative Name(s): ATP-AMP transphosphorylase ATP:AMP phosphotransferase Adenylate monophosphate kinase
Relevance: Catalyzes the reversible transfer of the terminal phosphate group between ATP and AMP. Plays an important role in cellular energy homeostasis and in adenine nucleotide metabolism.
Reference: "Genome sequence of Shigella flexneri 2a: insights into pathogenicity through comparison with genomes of Escherichia coli K12 and O157." Jin Q., Yuan Z., Xu J., Wang Y., Shen Y., Lu W., Wang J., Liu H., Yang J., Yang F., Zhang X., Zhang J., Yang G., Wu H., Qu D., Dong J., Sun L., Xue Y. Yu J. Nucleic Acids Res. 30:4432-4441(2002)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Shigella flexneri Adenylate kinase(adk)
- Regular price
- ¥120,800 JPY
- Sale price
- ¥120,800 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Shigella flexneri Invasin (IpaD)
- Regular price
- ¥120,800 JPY
- Sale price
- ¥120,800 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Adenylate kinase 2, mitochondrial(AK2)
- Regular price
- ¥80,400 JPY
- Sale price
- ¥80,400 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Escherichia coli Adenylate kinase(adk)
- Regular price
- ¥120,800 JPY
- Sale price
- ¥120,800 JPY
- Regular price
-
- Unit price
- per
Sold out