Recombinant Saccharomyces cerevisiae Nicotinamidase(PNC1)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Saccharomyces cerevisiae Nicotinamidase(PNC1)

CSB-EP346834SVGe1
Regular price
¥110,200 JPY
Sale price
¥110,200 JPY
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: Yes

Lead time: 3-7 working days

Research Topic: Microbiology

Uniprot ID: P53184

Gene Names: PNC1

Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

AA Sequence: MKTLIVVDMQNDFISPLGSLTVPKGEELINPISDLMQDADRDWHRIVVTRDWHPSRHISFAKNHKDKEPYSTYTYHSPRPGDDSTQEGILWPVHCVKNTWGSQLVDQIMDQVVTKHIKIVDKGFLTDREYYSAFHDIWNFHKTDMNKYLEKHHTDEVYIVGVALEYCVKATAISAAELGYKTTVLLDYTRPISDDPEVINKVKEELKAHNINVVDK

Expression Region: 1-216aa

Sequence Info: Full Length

Source: E.coli

Tag Info: NO-tagged

MW: 25 kDa

Alternative Name(s): Nicotinamide deamidase

Relevance: Catalyzes the deamidation of nicotinamide, an early step in the NAD+ salvage pathway. Positively regulates SIR2-mediated silencing and longevity by preventing the accumulation of intracellular nicotinamide, an inhibitor of SIR2, during times of stress. Acts also on nicotinyl hydroxamate.

Reference: "Identification and functional analysis of the Saccharomyces cerevisiae nicotinamidase gene, PNC1." Ghislain M., Talla E., Francois J.M. Yeast 19:215-224(2002)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share