
>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20170405
Research areas: Microbiology
Target / Protein: omp
Biologically active: Not Tested
Expression system: E.coli
Species of origin: Rickettsia japonica (strain ATCC VR-1363 / YH)
Delivery time: 3-7 business days
Uniprot ID: Q52764
AA Sequence: CNGPGGMNKQGTGTLLGGAGGALLGSQFGKGTGQLVGVGVGALLGAVLGGQIGAGMDEQDRRLAELTSQRALETAPSGSNVEWRNPDNGNYGYVTPNKTYRNSTGQYCREYTQTVVIGGKQQKAYGNACRQPDGQWQVVN
Tag info: N-terminal 6xHis-SUMO-tagged
Expression Region: 20-159aa
Protein length: Full Length
MW: 30.5 kDa
Alternative Name(s):
Relevance:
Reference: "Specific amplification of Rickettsia japonica DNA from clinical specimens by PCR."Furuya Y., Katayama T., Yoshida Y., Kaiho I.J. Clin. Microbiol. 33:487-489(1995)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Rickettsia japonica 17KDA surface antigen(omp)
- Regular price
- ¥122,900 JPY
- Sale price
- ¥122,900 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Rickettsia conorii Outer membrane protein A(ompA),partial
- Regular price
- ¥122,900 JPY
- Sale price
- ¥122,900 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Sus scrofa Interleukin-33(IL33),partial
- Regular price
- ¥122,900 JPY
- Sale price
- ¥122,900 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Escherichia coli Outer membrane protein C(ompC)
- Regular price
- ¥122,900 JPY
- Sale price
- ¥122,900 JPY
- Regular price
-
- Unit price
- per
Sold out