Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Others
Uniprot ID: P9WKA1
Gene Names: lepB
Organism: Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
AA Sequence: RPYLIPSESMEPTLHGCSTCVGDRIMVDKLSYRFGSPQPGDVIVFRGPPSWNVGYKSIRSHNVAVRWVQNALSFIGFVPPDENDLVKRVIAVGGQTVQCRSDTGLTVNGRPLKEPYLDPATMMADPSIYPCLGSEFGPVTVPPGRVWVMGDNRTHSADSRAHCPLLCTDDPLPGTVPVANVIGKARLIVWPPSRWGVVRSVNPQQGR
Expression Region: 88-294aa
Sequence Info: Extracellular Domain
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
MW: 38.6 kDa
Alternative Name(s): Leader peptidase I
Relevance:
Reference: Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.Kelkar D.S., Kumar D., Kumar P., Balakrishnan L., Muthusamy B., Yadav A.K., Shrivastava P., Marimuthu A., Anand S., Sundaram H., Kingsbury R., Harsha H.C., Nair B., Prasad T.S., Chauhan D.S., Katoch K., Katoch V.M., Kumar P. , Chaerkady R., Ramachandran S., Dash D., Pandey A.Mol. Cell. Proteomics 10:M111.011627-M111.011627(2011)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer，50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.