Recombinant Mycobacterium tuberculosis Immunogenic protein MPT64(mpt64)

Recombinant Mycobacterium tuberculosis Immunogenic protein MPT64(mpt64)

CSB-EP358713MVZ
Regular price
¥121,400 JPY
Sale price
¥121,400 JPY
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170405

Research areas: others

Target / Protein: mpt64

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

Delivery time: 3-7 business days

Uniprot ID: P0A5Q4

AA Sequence: APKTYCEELKGTDTGQACQIQMSDPAYNINISLPSYYPDQKSLENYIAQTRDKFLSAATSSTPREAPYELNITSATYQSAIPPRGTQAVVLKVYQNAGGTHPTTTYKAFDWDQAYRKPITYDTLWQADTDPLPVVFPIVQGELSKQTGQQVSIAPNAGLDPVNYQNFAVTNDGVIFFFNPGELLPEAAGPTQVLVPRSAIDSMLA

Tag info: N-terminal 6xHis-tagged

Expression Region: 24-228aa

Protein length: Full Length

MW: 26.4 kDa

Alternative Name(s): Antigen MPT64

Relevance:

Reference: "High-level heterologous expression and secretion in rapidly growing nonpathogenic mycobacteria of four major Mycobacterium tuberculosis extracellular proteins considered to be leading vaccine candidates and drug targets." Harth G., Lee B.Y., Horwitz M.A. Infect. Immun. 65:2321-2328(1997)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

You may also like

  • Recombinant Mycobacterium tuberculosis Immunogenic protein MPT64(mpt64)
    Regular price
    ¥121,400 JPY
    Sale price
    ¥121,400 JPY
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Mycobacterium tuberculosis Immunogenic protein MPT64(mpt64)
    Regular price
    ¥73,400 JPY
    Sale price
    ¥73,400 JPY
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Mycobacterium tuberculosis Immunogenic protein MPT64(mpt64)
    Regular price
    ¥133,300 JPY
    Sale price
    ¥133,300 JPY
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Mycobacterium tuberculosis Immunogenic protein MPT64(mpt64)
    Regular price
    ¥133,200 JPY
    Sale price
    ¥133,200 JPY
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share