
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: Yes
Lead time: 3-7 working days
Research Topic: Others
Uniprot ID: P9WQN8
Gene Names: fbpC
Organism: Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
AA Sequence: AFSRPGLPVEYLQVPSASMGRDIKVQFQGGGPHAVYLLDGLRAQDDYNGWDINTPAFEEYYQSGLSVIMPVGGQSSFYTDWYQPSQSNGQNYTYKWETFLTREMPAWLQANKGVSPTGNAAVGLSMSGGSALILAAYYPQQFPYAASLSGFLNPSEGWWPTLIGLAMNDSGGYNANSMWGPSSDPAWKRNDPMVQIPRLVANNTRIWVYCGNGTPSDLGGDNIPAKFLEGLTLRTNQTFRDTYAADGGRNGVFNFPPNGTHSWPYWNEQLVAMKADIQHVLNGATPPAAPAAPAA
Expression Region: 46-340aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal 6xHis-tagged
MW: 36.1 kDa
Alternative Name(s): Acyl-CoA:diacylglycerol acyltransferase Antigen 85 complex C Short name: 85C Short name: Ag85C Fibronectin-binding protein C Short name: Fbps C
Relevance: The antigen 85 proteins (FbpA, FbpB, FbpC) are responsible for the high affinity of mycobacteria to fibronectin, a large adhesive glycoprotein, which facilitates the attachment of M.tuberculosis to murine alveolar macrophages (AMs). They also help to maintain the integrity of the cell wall by catalyzing the transfer of mycolic acids to cell wall arabinogalactan and through the synthesis of alpha,alpha-trehalose dimycolate (TDM, cord factor). They catalyze the transfer of a mycoloyl residue from one molecule of alpha,alpha-trehalose monomycolate (TMM) to another TMM, leading to the formation of TDM
Reference: "Whole-genome comparison of Mycobacterium tuberculosis clinical and laboratory strains."Fleischmann R.D., Alland D., Eisen J.A., Carpenter L., White O., Peterson J.D., DeBoy R.T., Dodson R.J., Gwinn M.L., Haft D.H., Hickey E.K., Kolonay J.F., Nelson W.C., Umayam L.A., Ermolaeva M.D., Salzberg S.L., Delcher A., Utterback T.R. Fraser C.M.J. Bacteriol. 184:5479-5490(2002)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Mycobacterium tuberculosis Diacylglycerol acyltransferase-mycolyltransferase Ag85A(fbpA),partial
- Regular price
- ¥121,200 JPY
- Sale price
- ¥121,200 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Mycobacterium tuberculosis Diacylglycerol acyltransferase/mycolyltransferase Ag85A(fbpA)
- Regular price
- ¥119,100 JPY
- Sale price
- ¥119,100 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Mycobacterium tuberculosis Diacylglycerol acyltransferase-mycolyltransferase Ag85B(fbpB)
- Regular price
- ¥121,200 JPY
- Sale price
- ¥121,200 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Mycobacterium tuberculosis Diacylglycerol acyltransferase-mycolyltransferase Ag85C(fbpC)
- Regular price
- ¥121,200 JPY
- Sale price
- ¥121,200 JPY
- Regular price
-
- Unit price
- per
Sold out