Recombinant Mouse Tyrosine-protein kinase JAK1(Jak1),partial

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Mouse Tyrosine-protein kinase JAK1(Jak1),partial

CSB-EP011930MO
Regular price
¥103,100 JPY
Sale price
¥103,100 JPY
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: P52332

Gene Names: Jak1

Organism: Mus musculus (Mouse)

AA Sequence: EEQNPDIVSEKQPTTEVDPTHFEKRFLKRIRDLGEGHFGKVELCRYDPEGDNTGEQVAVKSLKPESGGNHIADLKKEIEILRNLYHENIVKYKGICMEDGGNGIKLIMEFLPSGSLKEYLPKNKNKINLKQQLKYAIQICKGMDYLGSRQYVHRDLAARNVLVESEHQVKIGDFGLTKAIETDKEYYTVKDDRDSPVFWYAPECLIQCKFYIASDVWSFGVTLHELLTYCDSDFSPMALFLKMIGPTHGQMTVTRLVKTLKEGKRLPCPPNCPDEVYQLMRKCWEFQPSNRTTFQNLIEGFEALL

Expression Region: 848-1152aa

Sequence Info: Partial

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

MW: 39.1 kDa

Alternative Name(s): Janus kinase 1 Short name: JAK-1

Relevance: Tyrosine kinase of the non-receptor type, involved in the IFN-alpha/beta/gamma signal pathway. Kinase partner for the interleukin (IL)-2 receptor. ATP + a [protein]-L-tyrosine = ADP + a [protein]-L-tyrosine phosphate.

Reference: "Molecular cloning of the murine JAK1 protein tyrosine kinase and its expression in the mouse central nervous system."Yang X., Chung D., Cepko C.L.J. Neurosci. 13:3006-3017(1993)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share