Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Mus musculus (Mouse)
Uniprot NO.:Q925E8
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MDFKRVKEYFAWLYYQYQIITCCAVMEPWEQSMLNTIILTIVAMVVYTAYVFIPIHIRLA WEFFSKICGYDSSISN
Protein Names:Recommended name: Serine palmitoyltransferase small subunit B Alternative name(s): Protein ADMP Small subunit of serine palmitoyltransferase B Short name= ssSPTb
Gene Names:Name:Sptssb Synonyms:Admp, Sssptb
Expression Region:1-76
Sequence Info:full length protein