Recombinant Mouse NACHT, LRR and PYD domains-containing protein 3(Nlrp3),partial

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Mouse NACHT, LRR and PYD domains-containing protein 3(Nlrp3),partial

CSB-EP823181MO
Regular price
¥120,200 JPY
Sale price
¥120,200 JPY
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: Q8R4B8

Gene Names: Nlrp3

Organism: Mus musculus (Mouse)

AA Sequence: MTSVRCKLAQYLEDLEDVDLKKFKMHLEDYPPEKGCIPVPRGQMEKADHLDLATLMIDFNGEEKAWAMAVWIFAAINRRDLWEKAKKDQPEWNDTCTSHSSMVCQEDSLEEEWMGLLGYLSRISICKKKKDYCKMYRRHVRSRFYSIKDRNAR

Expression Region: 1-153aa

Sequence Info: Partial

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 34.2 kDa

Alternative Name(s): Cold autoinflammatory syndrome 1 protein homolog Cryopyrin Mast cell maturation-associated-inducible protein 1 PYRIN-containing APAF1-like protein 1

Relevance: May function as an inducer of apoptosis. Interacts selectively with ASC and this complex may function as an upstream activator of NF-kappa-B signaling. Inhibits TNF-alpha induced activation and nuclear translocation of RELA/NF-KB p65. Also inhibits transcriptional activity of RELA (By similarity). Activates caspase-1 as part of the NALP3 inflammasome complex in response to a number of triggers including bacterial or viral infection which leads to processing and release of IL1B and IL18.

Reference: "Induction of PYPAF1 during in vitro maturation of mouse mast cells."Kikuchi-Yanoshita R., Taketomi Y., Koga K., Sugiki T., Atsumi Y., Saito T., Ishii S., Hisada M., Suzuki-Nishimura T., Uchida M.K., Moon T.-C., Chang H.-W., Sawada M., Inagaki N., Nagai H., Murakami M., Kudo I.J. Biochem. 134:699-709(2003)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

You may also like

  • Recombinant Human NACHT, LRR and PYD domains-containing protein 3(NLRP3),partial
    Regular price
    ¥96,000 JPY
    Sale price
    ¥96,000 JPY
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Baculoviral IAP repeat-containing protein 1(NAIP) ,partial
    Regular price
    ¥80,000 JPY
    Sale price
    ¥80,000 JPY
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Mouse SAM domain and HD domain-containing protein 1(SAMHD1),partial
    Regular price
    ¥102,300 JPY
    Sale price
    ¥102,300 JPY
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Mouse Protein CYR61(Cyr61)
    Regular price
    ¥102,300 JPY
    Sale price
    ¥102,300 JPY
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share