Recombinant Mouse Macrophage colony-stimulating factor 1(Csf1),partial

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Mouse Macrophage colony-stimulating factor 1(Csf1),partial

CSB-RP077774m
Regular price
¥109,400 JPY
Sale price
¥109,400 JPY
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: P07141

Gene Names: Csf1

Organism: Mus musculus (Mouse)

AA Sequence: KEVSEHCSHMIGNGHLKVLQQLIDSQMETSCQIAFEFVDQEQLDDPVCYLKKAFFLVQDIIDETMRFKDNTPNANATERLQELSNNLNSCFTKDYEEQNKACVRTFHETPLQLLEKIKNFFNETKNLLEKDWNIFTKNCNNSFAKCSSRDVVTKPDCNCLYPKATPSSDPASASPHQPPAPSMAPLAGLAWDDSQRTEGSSLLPSELPLRIEDPGSAKQRPPRSTCQTLE

Expression Region: 33-262

Sequence Info: Partial

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

MW: 30 kDa

Alternative Name(s):

Relevance: Cytokine that plays an essential role in the regulation of survival, proliferation and differentiation of hatopoietic precursor cells, especially mononuclear phagocytes, such as macrophages and monocytes. Promotes the release of proinflammatory chokines, and thereby plays an important role in innate immunity and in inflammatory processes. Plays an important role in the regulation of osteoclast proliferation and differentiation, the regulation of bone resorption, and is required for normal bone development. Required for normal male and fale fertility. Promotes reorganization of the actin cytoskeleton, regulates formation of mbrane ruffles, cell adhesion and cell migration. Plays a role in lipoprotein clearance.

Reference: Structure of macrophage colony stimulating factor bound to FMS diverse signaling assemblies of class III receptor tyrosine kinases.Chen X., Liu H., Focia P.J., Shim A.H., He X.Proc. Natl. Acad. Sci. U.S.A. 105:18267-18272(2008)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share