>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20171018
Research areas: Immunology
Target / Protein: Ly6e
Biologically active: Not Tested
Expression system: E.coli
Species of origin: Mus musculus (Mouse)
Delivery time: 3-7 business days
Uniprot ID: Q64253
AA Sequence: LMCFSCTDQKNNINCLWPVSCQEKDHYCITLSAAAGFGNVNLGYTLNKGCSPICPSENVNLNLGVASVNSYCCQSSFCNFSA
Tag info: N-terminal 6xHis-B2M-tagged
Expression Region: 21-102aa
Protein length: Full Length
MW: 22.8 kDa
Alternative Name(s): Stem cell antigen 2 Thymic shared antigen 1
Relevance: Involved in T-cell development.
Reference: "Characterization of Ly-6M, a novel member of the Ly-6 family of hematopoietic proteins." Patterson J.M.M., Johnson M.H., Zimonjic D.B., Graubert T.A. Blood 95:3125-3132(2000)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.