
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 22-32 working days
Research Topic: Others
Uniprot ID: P01942
Gene Names: Hba
Organism: Mus musculus (Mouse)
AA Sequence: VLSGEDKSNIKAAWGKIGGHGAEYGAEALERMFASFPTTKTYFPHFDVSHGSAQVKGHGKKVADALASAAGHLDDLPGALSALSDLHAHKLRVDPVNFKLLSHCLLVTLASHHPADFTPAVHASLDKFLASVSTVLTSKYR
Expression Region: 2-142aa
Sequence Info: Full Length
Source: Yeast
Tag Info: N-terminal 6xHis-tagged
MW: 17 kDa
Alternative Name(s): Alpha-globinHemoglobin alpha chain
Relevance: Involved in oxygen transport from the lung to the various peripheral tissues.
Reference: The complete sequence of a chromosomal mouse alpha-globin gene reveals elements conserved throughout vertebrate evolution.Nishioka Y., Leder P.Cell 18:875-882(1979)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Mouse Hemoglobin subunit alpha(Hba)
- Regular price
- ¥102,300 JPY
- Sale price
- ¥102,300 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Hemoglobin subunit zeta(HBZ)
- Regular price
- ¥80,000 JPY
- Sale price
- ¥80,000 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Mouse Myoglobin(Mb)
- Regular price
- ¥102,300 JPY
- Sale price
- ¥102,300 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Mouse Myoglobin(Mb)
- Regular price
- ¥102,000 JPY
- Sale price
- ¥102,000 JPY
- Regular price
-
- Unit price
- per
Sold out