
>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20170405
Research areas: Neuroscience
Target / Protein: Glp1r
Biologically active: Not Tested
Expression system: E.coli
Species of origin: Mus musculus (Mouse)
Delivery time: 3-7 business days
Uniprot ID: O35659
AA Sequence: GPRPQGTTVSLSETVQKWREYRRQCQRFLTEAPLLATGLFCNRTFDDYACWPDGPPGSFVNVSCPWYLPWASSVLQGHVYRFCTAEGLWLHKDNSSLPWRDLSECEESKRGERNFPEEQLLSLY
Tag info: N-terminal 6xHis-SUMO-tagged
Expression Region: 22-145aa
Protein length: Extracellular Domain
MW: 30.4 kDa
Alternative Name(s): Short name: GLP-1 receptor Short name: GLP-1-R Short name: GLP-1R
Relevance: This is a receptor for glucagon-like peptide 1. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase.
Reference: "Mouse pancreatic beta-cells exhibit preserved glucose competence after disruption of the glucagon-like peptide-1 receptor gene."Flamez D., van Breusegem A., Scrocchi L.A., Quartier E., Pipeleers D., Drucker D.J., Schuit F.Diabetes 47:646-652(1998)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Mouse Glucagon-like peptide 1 receptor(Glp1r),partial
- Regular price
- ¥102,300 JPY
- Sale price
- ¥102,300 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Glucagon-like peptide 1 receptor(GLP1R),partial
- Regular price
- ¥80,000 JPY
- Sale price
- ¥80,000 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Rat Glucagon-like peptide 1 receptor(Glp1r),partial
- Regular price
- ¥120,200 JPY
- Sale price
- ¥120,200 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Rat Glucagon-like peptide 1 receptor(Glp1r), partial
- Regular price
- ¥68,500 JPY
- Sale price
- ¥68,500 JPY
- Regular price
-
- Unit price
- per
Sold out