Recombinant Mouse Carboxylesterase 1C(Ces1c),partial

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Mouse Carboxylesterase 1C(Ces1c),partial

CSB-EP338557MOe1
Regular price
¥103,500 JPY
Sale price
¥103,500 JPY
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: Yes

Lead time: 3-7 working days

Research Topic: Others

Uniprot ID: P23953

Gene Names: Ces1c

Organism: Mus musculus (Mouse)

AA Sequence: HSLLPPVVDTTQGKVLGKYISLEGFEQPVAVFLGVPFAKPPLGSLRFAPPQPAEPWSFVKNATSYPPMCSQDAGWAKILSDMFSTEKEILPLKISEDCLYLNIYSPADLTKSSQLPVMVWIHGGGLVIGGASPYNGLALSAHENVVVVTIQYRLGIWGLFSTGDEHSPGNWAHLDQLAALRWVQDNIANFGGNPDSVTIFGESSGGISVSVLVLSPLGKDLFHRAISESGVVINTNVGKKNIQAVNEIIATLSQCNDTSSAAMVQCLRQKTESELLEISGKLVQYNISLSTMIDGVVLPKAPEEILAEKSFNTVPYIVGFNKQEFGWIIPMMLQNLLPEGKMNEETASLLLRRFHSELNISESMIPAVIEQYLRGVDDPAKKSELILDMFGDIFFGIPAVLLSRSLRDAGVSTYMYEFRYRPSFVSDKRPQTVEGDHGDEIFFVFGAPLLKEGASEEETNLSKMVMKFWANFARNGNPNGEGLPHWPEYDEQEGYLQIGATTQQAQRLKAEEVAFWTELLAKNPPETDPTEH

Expression Region: 19-550aa

Sequence Info: Partial

Source: E.coli

Tag Info: NO-tagged

MW: 58.6 kDa

Alternative Name(s): Liver carboxylesterase N Lung surfactant convertase PES-N

Relevance: Involved in the detoxification of xenobiotics and in the activation of ester and amide prodrugs. Involved in the extracellular metabolism of lung surfactant.

Reference: "Proteome-wide characterization of N-glycosylation events by diagonal chromatography." Ghesquiere B., Van Damme J., Martens L., Vandekerckhove J., Gevaert K. J. Proteome Res. 5:2438-2447(2006)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

You may also like

  • Recombinant Mouse Carboxylesterase 1C(Ces1c),partial
    Regular price
    ¥102,500 JPY
    Sale price
    ¥102,500 JPY
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Mouse Carboxylesterase 1C(Ces1c),partial
    Regular price
    ¥102,800 JPY
    Sale price
    ¥102,800 JPY
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Mouse Carboxylesterase 1C(Ces1c),partial
    Regular price
    ¥103,500 JPY
    Sale price
    ¥103,500 JPY
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Mouse Carboxylesterase 1C(Ces1c),partial
    Regular price
    ¥102,500 JPY
    Sale price
    ¥102,500 JPY
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share