Recombinant Mouse C-X-C motif chemokine 10(Cxcl10)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Mouse C-X-C motif chemokine 10(Cxcl10)

CSB-RP092794m
Regular price
¥109,600 JPY
Sale price
¥109,600 JPY
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: P17515

Gene Names: Cxcl10

Organism: Mus musculus (Mouse)

AA Sequence: IPLARTVRCNCIHIDDGPVRMRAIGKLEIIPASLSCPRVEIIATMKKNDEQRCLNPESKTIKNLMKAFSQKRSKRAP

Expression Region: 22-98aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal GST-tagged

MW: 35.7 kDa

Alternative Name(s): 10KDA interferon gamma-induced protein Short name: Gamma-IP10 Short name: IP-10

Relevance: In addition to its role as a proinflammatory cytokine, may participate in T-cell effector function and perhaps T-cell development.

Reference: "Structure of mouse IP-10, a chemokine."Jabeen T., Leonard P., Jamaluddin H., Acharya K.R.Acta Crystallogr. D 64:611-619(2008)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share