Recombinant Methanosarcina acetivorans Tetrahydromethanopterin S-methyltransferase subunit G(mtrG)

CSB-CF848495MFB

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)

Uniprot NO.:Q8TU05

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDGKAPAAYVDPAEFNEVMKRLEKIDEKVEFVNSEVAQRIGKKVGRDIGILYGAVVGLLL FLIYVSVSSMFTI

Protein Names:Recommended name: Tetrahydromethanopterin S-methyltransferase subunit G EC= 2.1.1.86 Alternative name(s): N5-methyltetrahydromethanopterin--coenzyme M methyltransferase subunit G

Gene Names:Name:mtrG Ordered Locus Names:MA_0270

Expression Region:1-73

Sequence Info:full length protein