
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Methanococcus maripaludis (strain S2 / LL)
Uniprot NO.:Q6LXR6
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSVALKKFFSKRGQLSLEFSVLVLAVITAAILLGYHLIVSSKAVQESNIDTINNTHNTAI DALSEVS
Protein Names:Recommended name: UPF0333 protein MMP1283
Gene Names:Ordered Locus Names:MMP1283
Expression Region:1-67
Sequence Info:full length protein