
>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20170725
Research areas: Others
Target / Protein: pyrE
Biologically active: Not Tested
Expression system: E.coli
Species of origin: Laribacter hongkongensis (strain HLHK9)
Delivery time: 3-7 business days
Uniprot ID: C1D6F5
AA Sequence: MSDFRQDFIRFAVEEQVLRFGEFVTKAGRPSPYFFNAGLFNHGASLLSLARFYARSISESGIAFDMLFGPAYKGIVLAGATAMMLAEQGRDVPFAFNRKEAKDHGEGGTLIGAPLKGRVLIIDDVISAGTSVRESVEIIRANGAEPAGVAIALDRMERGQGELSATQEVAQKFGLPVVAIASLDDLLGFLAGSPDLADNLTRVEAYRTQYGVR
Tag info: N-terminal 6xHis-SUMO-tagged
Expression Region: 1-213aa
Protein length: Full Length
MW: 38.9 kDa
Alternative Name(s): Short name:OPRT Short name:OPRTase
Relevance: Catalyzes the transfer of a ribosyl phosphate group from 5-phosphoribose 1-diphosphate to orotate, leading to the formation of orotidine monophosphate (OMP).
Reference: "The complete genome and proteome of Laribacter hongkongensis reveal potential mechanisms for adaptations to different temperatures and habitats."Woo P.C.Y., Lau S.K.P., Tse H., Teng J.L.L., Curreem S.O., Tsang A.K.L., Fan R.Y.Y., Wong G.K.M., Huang Y., Loman N.J., Snyder L.A.S., Cai J.J., Huang J.-D., Mak W., Pallen M.J., Lok S., Yuen K.-Y.PLoS Genet. 5:E1000416-E1000416(2009)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Phosphoribosylamine--glycine ligase(purD)
- Regular price
- ¥123,200 JPY
- Sale price
- ¥123,200 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Intestinal-type alkaline phosphatase(ALPI),partial
- Regular price
- ¥82,000 JPY
- Sale price
- ¥82,000 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Hypocrea rufa Endo-beta-1,6-galactanase(6GAL)
- Regular price
- ¥123,200 JPY
- Sale price
- ¥123,200 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Agrobacterium sp. 3-phosphoshikimate 1-carboxyvinyltransferase(aroA)
- Regular price
- ¥123,200 JPY
- Sale price
- ¥123,200 JPY
- Regular price
-
- Unit price
- per
Sold out