
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Developmental Biology
Uniprot ID: P08151
Gene Names: GLI1
Organism: Homo sapiens (Human)
AA Sequence: QEPSYQSPKFLGGSQVSPSRAKAPVNTYGPGFGPNLPNHKSGSYPTPSPCHENFVVGANRASHRAAAPPRLLPPLPTCYGPLKVGGTNPSCGHPEVGRLGGGPALYPPPEGQVCNPLDSLDLDNTQLDFVAILDEPQGLSPPPSHDQRGSSGHTPPPSGPPNMAVGNMSVLLRSLPGETEFLNSSA
Expression Region: 921-1106aa
Sequence Info: Partial
Source: E.coli
Tag Info: N-terminal 6xHis-tagged
MW: 23.3 kDa
Alternative Name(s): Glioma-associated oncogeneOncogene GLI
Relevance: Acts as a transcriptional activator. May regulate the transcription of specific genes during normal development. May play a role in craniofacial development and digital development, as well as development of the central nervous syst and gastrointestinal tract. Mediates SHH signaling and thus cell proliferation and differentiation.
Reference: Polymorphic variants of the human oncogene GLI1 function similarly.Yoon J.W., Kent P., Clark A., Patterson J., Villavicencio E., Iannaccone P., Walterhouse D.A novel splice variant of GLI1 that promotes glioblastoma cell migration and invasion.Lo H.W., Zhu H., Cao X., Aldrich A., Ali-Osman F.Cancer Res. 69:6790-6798(2009)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Human Glioma pathogenesis-related protein 1(GLIPR),partial
- Regular price
- ¥80,800 JPY
- Sale price
- ¥80,800 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Transcription factor PU.1(SPI1)
- Regular price
- ¥91,400 JPY
- Sale price
- ¥91,400 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human N-myc proto-oncogene protein(MYCN)
- Regular price
- ¥90,200 JPY
- Sale price
- ¥90,200 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Zinc finger protein 592(ZNF592) ,partial
- Regular price
- ¥80,800 JPY
- Sale price
- ¥80,800 JPY
- Regular price
-
- Unit price
- per
Sold out